PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG305200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 370aa    MW: 40345.7 Da    PI: 8.8924
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG305200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.8e-19205259256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Le++F+++++++ +++ +LAkkl+L  rqV vWFqNrRa+ k
  Pavir.1NG305200.2.p 205 RKKLRLSKEQSAFLEDCFKEHSTLTPKQKSDLAKKLNLRPRQVEVWFQNRRARTK 259
                          678899***********************************************98 PP

2HD-ZIP_I/II123.88.3e-40205294191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LE++F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+ +e+Lkr++++l++en+rL++ev+eLr +
  Pavir.1NG305200.2.p 205 RKKLRLSKEQSAFLEDCFKEHSTLTPKQKSDLAKKLNLRPRQVEVWFQNRRARTKLKQTEVGCEYLKRCCETLAQENRRLHREVAELR-A 293
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Pavir.1NG305200.2.p 294 L 294
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.29E-18198262IPR009057Homeodomain-like
PROSITE profilePS5007116.876201261IPR001356Homeobox domain
SMARTSM003891.8E-16203265IPR001356Homeobox domain
CDDcd000865.97E-17205262No hitNo description
PfamPF000462.5E-16205259IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-18205259IPR009057Homeodomain-like
PROSITE patternPS000270236259IPR017970Homeobox, conserved site
PfamPF021831.3E-9261294IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.2E-22261304IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MPDNHSGTST AMPIFRFYYF KLNTSELIPL LAGPTRLCRP IKRSFLRPKT HSWRVHRGGR  60
IGAPPPCPAA DQSIPASAPP RRPPASPSTP PSSPSDPAAP LVLLAAGKEY HELLLELGVG  120
TARRTGQDNQ RTPTQPGEDA QDQEDDGEAC FRIESPVELS LGCRLLPASA ETGSANSEEC  180
RRGFEAADLE GAEDEENSGV GGGVRKKLRL SKEQSAFLED CFKEHSTLTP KQKSDLAKKL  240
NLRPRQVEVW FQNRRARTKL KQTEVGCEYL KRCCETLAQE NRRLHREVAE LRALRTAPYP  300
FYGHLPAAGF STARMCPSCD AKVITAHHPS ITPTSPAVAP PSPVSTSFAR PHFGPFTVVH  360
PRAPPPATS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253261RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952725.11e-144PREDICTED: homeobox-leucine zipper protein HOX7-like
SwissprotA2X6741e-75HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLK3YZM61e-144K3YZM6_SETIT; Uncharacterized protein
STRINGSi019736m1e-144(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-57homeobox from Arabidopsis thaliana